PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00021573-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family NF-YB
Protein Properties Length: 195aa    MW: 20892.1 Da    PI: 5.0987
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00021573-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB182.14.7e-5725120297
               NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyre 92 
                         reqdr+lPianvsrimkk+lPan+kisk+aketvqecvsefisf+t+easdkcqrekrktingddllwa++tlGfe+yveplk+yl+k+re
  WALNUT_00021573-RA  25 REQDRLLPIANVSRIMKKALPANGKISKEAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFEEYVEPLKIYLQKFRE 115
                         89***************************************************************************************** PP

               NF-YB  93 legek 97 
                         +egek
  WALNUT_00021573-RA 116 MEGEK 120
                         ***97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.103.6E-5520136IPR009072Histone-fold
SuperFamilySSF471131.23E-4027126IPR009072Histone-fold
PfamPF008081.3E-273094IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.7E-215876No hitNo description
PROSITE patternPS0068506177IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.7E-217795No hitNo description
PRINTSPR006151.7E-2196114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 195 aa     Download sequence    Send to blast
MADSEDESGG GQNNANFNGE YSSLREQDRL LPIANVSRIM KKALPANGKI SKEAKETVQE  60
CVSEFISFIT GEASDKCQRE KRKTINGDDL LWAMTTLGFE EYVEPLKIYL QKFREMEGEK  120
SSSTTSTAVA GGRQGERDIG GDGSVGNSGN SGVGMMYGGV QSTMMMMGHN YHGGHDMYGS  180
SVSGSGSGAS SGRQR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_B3e-4923115294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A3e-4923115294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003634760.18e-86PREDICTED: nuclear transcription factor Y subunit B-3
RefseqXP_010644567.18e-86PREDICTED: nuclear transcription factor Y subunit B-3
SwissprotO233107e-72NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBLD7UAG59e-86D7UAG5_VITVI; Putative uncharacterized protein
STRINGVIT_19s0015g00440.t012e-85(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59134150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.11e-70nuclear factor Y, subunit B3